PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00099.1_g00014.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 259aa    MW: 28059.2 Da    PI: 8.8474
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00099.1_g00014.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.29.8e-4053111462
                   zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                               al+cprCdstntkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rknk+s+
  Rsa1.0_00099.1_g00014.1  53 LALRCPRCDSTNTKFCYYNNYSLSQPRYFCKSCRRYWTKGGTLRNIPVGGGCRKNKRST 111
                              5789****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-3148108IPR003851Zinc finger, Dof-type
PfamPF027016.6E-3455109IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.51655109IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105793IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MDHLLQHQDV FGNYIKARDA MGVSCPSNPT ELDGNQKKSS PATGTAKPQP PELALRCPRC  60
DSTNTKFCYY NNYSLSQPRY FCKSCRRYWT KGGTLRNIPV GGGCRKNKRS TSSATRSLRT  120
TPEPAFSAAS FGGFGNNEHT DLSLAFALLN KRPQGNSSHL GFPSAFGNSN SHQTDMESVF  180
GTSQKIENAG YAFGNGSSGL DMAMSDPNKV LWGFPWQMNG ESFGMMNMGG GGGGGHADQI  240
DSGREIWTNM NYINSGALM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013656730.11e-165PREDICTED: dof zinc finger protein DOF5.3-like isoform X1
SwissprotQ84TE91e-146DOF53_ARATH; Dof zinc finger protein DOF5.3
TrEMBLA0A078H4251e-166A0A078H425_BRANA; BnaA10g13030D protein
STRINGBra002504.1-P1e-164(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61321845
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.11e-134TARGET OF MONOPTEROS 6